"entity" : "1914245", "actions" : [ { }, } "disableLabelLinks" : "false", ;(function($) { LITHIUM.AjaxSupport.fromLink('#kudoEntity_5', 'kudoEntity', '#ajaxfeedback_5', 'LITHIUM:ajaxError', {}, 'nRuRg_mtB-gcWlB2gEYSUCVxVrnLl-CevcF0bsysReo. var count = 0; }, }, "truncateBody" : "true", "action" : "addClassName" lithadmin: [] { "actions" : [ "actions" : [ LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-1914143 .lia-rating-control-passive', '#form_3'); ] "action" : "rerender" "initiatorBinding" : true, { "action" : "rerender" ] { "useTruncatedSubject" : "true", "actions" : [ } })(LITHIUM.jQuery); // Pull in global jQuery reference "action" : "rerender" "eventActions" : [ }, { "action" : "addClassName" "event" : "ProductMessageEdit", "event" : "addThreadUserEmailSubscription", "componentId" : "kudos.widget.button", CallYa Allnet Flat M /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ }, "actions" : [ "event" : "addMessageUserEmailSubscription", { LITHIUM.SearchAutoCompleteToggle({"containerSelector":"#searchautocompletetoggle_6f0bff9796685d","enableAutoCompleteSelector":".search-autocomplete-toggle-link","enableAutocompleteSuccessEvent":"LITHIUM:ajaxSuccess:enableAutoComplete","disableAutoCompleteSelector":".lia-autocomplete-toggle-off","disableAutocompleteSuccessEvent":"LITHIUM:ajaxSuccess:disableAutoComplete","autoCompleteSelector":".lia-autocomplete-input"}); "actions" : [ } }, "context" : "", ] "context" : "envParam:entity", }, "action" : "rerender" "ajaxEvent" : "LITHIUM:lightboxRenderComponent", }; $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); }, LITHIUM.AjaxSupport.fromForm('#form_3', 'GiveRating', '#ajaxfeedback_3', 'LITHIUM:ajaxError', {"useLoader":true,"event":"submit","httpMethod":"POST"}, true); ', 'ajax'); "action" : "rerender" { var watching = false; ] LITHIUM.StarRating('#any_6', false, 1, 'LITHIUM:starRating'); ] LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-1914203 .lia-rating-control-passive', '#form_5'); ] { } "context" : "", { "actions" : [ "disableLabelLinks" : "false", "action" : "rerender" } "event" : "MessagesWidgetMessageEdit", { "event" : "MessagesWidgetAnswerForm", "}); ] ] "messageViewOptions" : "1111110111111111111110111110100101001101" }, "event" : "deleteMessage", } "event" : "MessagesWidgetAnswerForm", } "context" : "envParam:quiltName", } "context" : "lia-deleted-state", "context" : "", "displayStyle" : "horizontal", { "event" : "approveMessage", "context" : "", LITHIUM.Dialog.options['-1644067994'] = {"contentContext":"valuesurveys.widget.survey-prompt-dialog","dialogOptions":{"minHeight":399,"draggable":false,"maxHeight":800,"resizable":false,"autoOpen":false,"width":610,"minWidth":610,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modal-simple lia-panel-dialog-modal-valuesurvey","position":["center","center"],"modal":true,"maxWidth":610,"ariaLabel":"Feedback for community"},"contentType":"ajax"}; "event" : "MessagesWidgetEditAnswerForm", "initiatorBinding" : true, Informier Deinen jetzigen Mobilfunk-Anbieter, dass Du Deine Handy-Nummer zu uns mitnehmen möchtest. ] { ] "event" : "MessagesWidgetEditAnswerForm", { { }, "action" : "rerender" "actions" : [ "initiatorDataMatcher" : "data-lia-message-uid" Der CallYa Allnet M kostet 14,99 Euro für 4 Wochen. "action" : "rerender" "action" : "rerender" $('#node-menu li.has-sub>a').on('click', function(){ "event" : "RevokeSolutionAction", $(document).keydown(function(e) { }, "event" : "addMessageUserEmailSubscription", { { }, "actions" : [ { { $('.menu-container').on('click','.community-user-menu-btn.active', {'selector' : '.css-user-menu' }, handleClose); "action" : "rerender" }, "messageViewOptions" : "1111110111111111111110111110100101001101" } else { "action" : "rerender" "context" : "", ] "event" : "MessagesWidgetMessageEdit", { } LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper_5","componentSelector":"#lineardisplaymessageviewwrapper_5","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":1914203,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. ","ignoreOnChangeCssClasses":[],"disableFormOnSubmit":true,"buttonWrapperSelector":".lia-button-wrapper","showUnsavedDataWarningDataKey":"showUnsavedDataWarning","liaBodyTagId":"#lia-body"}); } LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-1914266 .lia-rating-control-passive', '#form_7'); { // --> }, }, }, "context" : "", Wähl jetzt, ob Du bisher einen Vertrag oder eine Prepaid-Karte genutzt hast. { ] } ] }, }); { "event" : "unapproveMessage", window.NREUM||(NREUM={});NREUM.info={"errorBeacon":"bam-cell.nr-data.net","licenseKey":"90ec53e80f","agent":"","beacon":"bam-cell.nr-data.net","applicationTime":1222,"applicationID":"309530949","transactionName":"M1BRYEAEWBVYURYLWAoaZFFQSmIHSVcRFkUdZVJTV19wCUtHDzZYFFxQZFMCUw==","queueTime":0,"atts":"HxdGFggeFA1afA0GUjBMQ1EQXxQAVkAXDxoGWlJGVkcaRF9AAw9SLVERDgNXBFUBA1RRB10ABxgQDlUzSlcQK1NGDx4FHkddBWlTBQd5BVhWFghHcAlLRw82WBRcUGRTAlNEFRAJAXoLV1pYV0cMRF9TDhFSRhkRX1EnWRIbCEAEVghGVhYeR10FbUpAWBUFU1ANUAFVABRWVVRRSQEKBFBIV1BfAk8EAQVTAwNXAQ4ED1NAThUPVn1bVgB\/AhsIQCNFB11aQm0mVwpVawNAG0ZeUGZXFkIwC2MXB0UdFwkWYSB6I3pmQgtTRHNhe39FWwNKQQMFUhcVZHx3N3NGTV0SC1RKXFcJDUV6L3R7NkIIRkhO"}, \n\t\t\t\t\t\tDu hast die maximal erlaubte Anzahl von Bewertungen für einen Beitrag erreicht.\n\t\t\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\n\n\t\t\t\n\t\t","dialogOptions":{"minHeight":174,"draggable":true,"maxHeight":600,"resizable":true,"autoOpen":false,"width":310,"minWidth":310,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modeless-simple","position":["center","center"],"modal":false,"maxWidth":310},"contentType":"html"}; "event" : "ProductAnswer", "action" : "pulsate" ] Deinen Benutzernamen hast Du bei der Registrierung zu MeinVodafone festgelegt. } "useSimpleView" : "false", "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", { "selector" : "#kudosButtonV2_7", ] { window.NREUM||(NREUM={});NREUM.info={"errorBeacon":"bam-cell.nr-data.net","licenseKey":"90ec53e80f","agent":"","beacon":"bam-cell.nr-data.net","applicationTime":1222,"applicationID":"309530949","transactionName":"M1BRYEAEWBVYURYLWAoaZFFQSmIHSVcRFkUdZVJTV19wCUtHDzZYFFxQZFMCUw==","queueTime":0,"atts":"HxdGFggeFA1afA0GUjBMQ1EQXxQAVkAXDxoGWlJGVkcaRF9AAw9SLVERDgNXBFUBA1RRB10ABxgQDlUzSlcQK1NGDx4FHkddBWlTBQd5BVhWFghHcAlLRw82WBRcUGRTAlNEFRAJAXoLV1pYV0cMRF9TDhFSRhkRX1EnWRIbCEAEVghGVhYeR10FbUpAWBUFU1ANUAFVABRWVVRRSQEKBFBIV1BfAk8EAQVTAwNXAQ4ED1NAThUPVn1bVgB\/AhsIQCNFB11aQm0mVwpVawNAG0ZeUGZXFkIwC2MXB0UdFwkWYSB6I3pmQgtTRHNhe39FWwNKQQMFUhcVZHx3N3NGTV0SC1RKXFcJDUV6L3R7NkIIRkhO"}. } "selector" : "#kudosButtonV2_5", { { }, }, "eventActions" : [ "eventActions" : [ }, "action" : "rerender" ... Mit den Einzelverbindungsnachweisen können Sie genau nachvollziehen, wofür Ihnen Guthaben abgezogen wurde. }, "quiltName" : "ForumMessage", ","loaderSelector":"#lineardisplaymessageviewwrapper_4 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); { }); "disableKudosForAnonUser" : "false", }); "event" : "deleteMessage", "actions" : [ LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-1914143 .lia-rating-control-passive', '#form_3'); "context" : "envParam:quiltName,product,contextId,contextUrl", "truncateBody" : "true", { "event" : "RevokeSolutionAction", }, ] }, "context" : "", { }, var neededkeys = [76, 79, 71, 77, 69, 73, 78]; "action" : "rerender" } "displayStyle" : "horizontal", "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", "}); $('#node-menu li.active').children('ul').show(); ] "action" : "rerender" "event" : "MessagesWidgetCommentForm", "showCountOnly" : "false", "action" : "rerender" }, "actions" : [ } LITHIUM.StarRating('#any_0_2', true, 2, 'LITHIUM:starRating'); { "eventActions" : [ "initiatorBinding" : true, "actions" : [ LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_42","feedbackSelector":".InfoMessage"}); { "actions" : [ } "}); "event" : "addMessageUserEmailSubscription", "action" : "rerender" { ] { ] "useTruncatedSubject" : "true", logmein: [76, 79, 71, 77, 69, 73, 78], { { "initiatorDataMatcher" : "data-lia-kudos-id" "event" : "ProductAnswer", "context" : "", } { { "context" : "", { watching = true; // If watching, pay attention to key presses, looking for right sequence. "disableLinks" : "false", "event" : "ProductMessageEdit", "action" : "rerender" "displayStyle" : "horizontal", $(document).keydown(function(e) { { { LITHIUM.AjaxSupport.ComponentEvents.set({ { { ] window.location.replace('/t5/user/userloginpage'); "actions" : [ "actions" : [ var handleOpen = function(event) { $(".label-tag-accordion div.js-toggle-more").on('click',function(e){ "event" : "deleteMessage", "disallowZeroCount" : "false", ] })(LITHIUM.jQuery); { "context" : "", { }, //$('#vodafone-community-header .lia-search-input-wrapper').css('display','table-cell')} "actions" : [ "actions" : [ "actions" : [ "disallowZeroCount" : "false", "action" : "rerender" "event" : "MessagesWidgetMessageEdit", { "context" : "", $(document).keydown(function(e) { }, "event" : "expandMessage", LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper_1","componentSelector":"#lineardisplaymessageviewwrapper_1","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":1914089,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. "context" : "", }, } "event" : "QuickReply", } "actions" : [ "disallowZeroCount" : "false", "forceSearchRequestParameterForBlurbBuilder" : "false", { LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_45","feedbackSelector":".InfoMessage"}); "actions" : [ "showCountOnly" : "false", window.location.replace('/t5/user/userloginpage'); "event" : "MessagesWidgetAnswerForm", "eventActions" : [ } "action" : "pulsate" } ] Unabhängig davon, wann der Betrag von Deinem Bankkonto abgebucht wird, kannst Du den Tarif nutzen, sobald die SIM-Karte und der Tarif aktiviert sind. Mit dem übertragenen Guthaben kann der Empfänger wie gewohnt anrufen, SMS oder MMS verschicken. lithadmin: [] ","ignoreOnChangeCssClasses":[],"disableFormOnSubmit":true,"buttonWrapperSelector":".lia-button-wrapper","showUnsavedDataWarningDataKey":"showUnsavedDataWarning","liaBodyTagId":"#lia-body"}); }, "actions" : [ } Der Basispreis pro Monat für Deinen gewählten CallYa Prepaid-Tarif bzw. { "actions" : [ { { "quiltName" : "ForumMessage", ] } { "event" : "unapproveMessage", } { ] }, "useSubjectIcons" : "true", "forceSearchRequestParameterForBlurbBuilder" : "false", ] { ', 'ajax'); { { "}); ], } } { Bist du sicher, dass du fortfahren möchtest? "actions" : [ }, "action" : "rerender" "actions" : [ Hotline: 22911 (kostenlos für CallYa-Kunden, bis zur Verbindung mit der Hotline (auf Wunsch)) Hotline: 0172 2290229 (Kosten für Mobilfunkanruf) Beratung & Bestellung: 0800-4440624693 (täglich 07:30 bis 22:00 Uhr). { } }, } // Oops. })(LITHIUM.jQuery); "eventActions" : [ { "event" : "MessagesWidgetEditCommentForm", }, "event" : "deleteMessage", "event" : "editProductMessage", "actions" : [ { { ] ] { "actions" : [ }, { "context" : "envParam:entity", { "useSubjectIcons" : "true", "context" : "", LITHIUM.AjaxSupport.ComponentEvents.set({ { ] "event" : "AcceptSolutionAction", { } "initiatorDataMatcher" : "data-lia-message-uid" { "context" : "envParam:selectedMessage", "useSimpleView" : "false", "actions" : [ "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", ], "action" : "rerender" ] "context" : "", "event" : "unapproveMessage", } { }); } "action" : "pulsate" }, } { ] } ] count++; }, // Reset the conditions so that someone can do it all again. "context" : "lia-deleted-state", }, { } "event" : "approveMessage", "context" : "", $(document).ready(function(){ "initiatorDataMatcher" : "data-lia-kudos-id" } "action" : "rerender" { } "forceSearchRequestParameterForBlurbBuilder" : "false", "action" : "rerender" { { }, }, { "initiatorDataMatcher" : "data-lia-message-uid" ] { Es werden Prepaid Tarife, Prepaid Tarife mit 30 Tage Option und 1 Monats Verträge im Vodafone Netz angeboten. // console.log('watching: ' + key); Du hast Deine Karte in einem unserer Shops gekauft?Dann haben wir Deine Daten schon. "action" : "rerender" { } } { }, return; "disableLinks" : "false", ], "actions" : [ }, "actions" : [ "action" : "rerender" }, "event" : "approveMessage", ","loaderSelector":"#lineardisplaymessageviewwrapper_2 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); } LITHIUM.AjaxSupport.fromLink('#kudoEntity_7', 'kudoEntity', '#ajaxfeedback_7', 'LITHIUM:ajaxError', {}, 'SWsayikYrDm-EknhVNKf1mgRo1T9rbRFvFjWzyg-PUc. ], "initiatorDataMatcher" : "data-lia-kudos-id" } "action" : "rerender" "quiltName" : "ForumMessage", }); ] } LITHIUM.SearchForm({"asSearchActionIdSelector":".lia-as-search-action-id","useAutoComplete":true,"selectSelector":".lia-search-form-granularity","useClearSearchButton":false,"buttonSelector":".lia-button-searchForm-action","asSearchActionIdParamName":"as-search-action-id","formSelector":"#lia-searchform_6f0bff9796685d","nodesModel":{"user|user":{"title":"Benutzer","inputSelector":".lia-search-input-user"},"vodafonede|community":{"title":"Community-Suche: Archiv_CallYa","inputSelector":".lia-search-input-message"},"Archiv_CallYa|forum-board":{"title":"Board-Suche: Archiv_CallYa","inputSelector":".lia-search-input-message"},"Vertrag|category":{"title":"Kategorie-Suche: Archiv_CallYa","inputSelector":".lia-search-input-message"}},"asSearchActionIdHeaderKey":"X-LI-AS-Search-Action-Id","inputSelector":"#messageSearchField_6f0bff9796685d_0:not(.lia-js-hidden)","clearSearchButtonSelector":null}); { "context" : "envParam:quiltName,expandedQuiltName", { Prepaid; Vodafone; Vodafone Top-up Back to all providers Direct top-up. "context" : "envParam:quiltName,message,product,contextId,contextUrl", } { { // Oops, not the right sequence, lets restart from the top. "eventActions" : [ LITHIUM.AjaxSupport.ComponentEvents.set({ "kudosable" : "true", "context" : "", "triggerEvent" : "click", "event" : "editProductMessage", "displayStyle" : "horizontal", } }, "actions" : [ ], "action" : "rerender" }, ], //} else { "truncateBody" : "true", { }, } LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_26","feedbackSelector":".InfoMessage"}); } // Oops, not the right sequence, lets restart from the top. { { "forceSearchRequestParameterForBlurbBuilder" : "false", "context" : "envParam:selectedMessage", Alle Preise inkl. "event" : "removeThreadUserEmailSubscription", "event" : "kudoEntity", "action" : "rerender" } "action" : "rerender" "actions" : [ "context" : "", "event" : "editProductMessage", LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-1914245 .lia-rating-control-passive', '#form_6'); "useTruncatedSubject" : "true", "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", { { "context" : "", }, } "context" : "", ] "context" : "", "context" : "envParam:selectedMessage", } zugreifen, ohne Dich jedes Mal einloggen zu "event" : "MessagesWidgetCommentForm", { "parameters" : { "displaySubject" : "true", ] } LITHIUM.MessageBodyDisplay('#bodyDisplay_4', '.lia-truncated-body-container', '#viewMoreLink', '.lia-full-body-container' ); "actions" : [ "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "context" : "envParam:selectedMessage", "quiltName" : "ForumMessage", "event" : "kudoEntity", ] { ] LITHIUM.MessageBodyDisplay('#bodyDisplay_7', '.lia-truncated-body-container', '#viewMoreLink', '.lia-full-body-container' ); } "initiatorDataMatcher" : "data-lia-kudos-id" }, { { LITHIUM.Auth.API_URL = '/t5/util/authcheckpage'; "event" : "addThreadUserEmailSubscription", } { }, } "context" : "envParam:quiltName,expandedQuiltName", ', 'ajax'); } { "context" : "", "action" : "rerender" ], "truncateBodyRetainsHtml" : "false", } }); LITHIUM.Dialog.options['1821930657'] = {"contentContext":" \n\n\t\n\t\t\n\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\t\t\n\t\t\t\t\t\tDu hast die maximal erlaubte Anzahl von Bewertungen für einen Beitrag erreicht.\n\t\t\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\n\n\t\t\t\n\t\t","dialogOptions":{"minHeight":174,"draggable":true,"maxHeight":600,"resizable":true,"autoOpen":false,"width":310,"minWidth":310,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modeless-simple","position":["center","center"],"modal":false,"maxWidth":310},"contentType":"html"}; ] "context" : "envParam:quiltName,message", ] ] }, Oder Du identifizierst Dich persönlich in einer Postfiliale in Deiner Nähe. { "action" : "rerender" } "truncateBody" : "true", { } "action" : "rerender" "message" : "1914179", LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_31","feedbackSelector":".InfoMessage"}); "context" : "", }); ;(function($) { "context" : "envParam:entity", "action" : "pulsate" } }, "context" : "", Wie das geht, liest Du im Hilfe-Bereich zu unserem Ident-Verfahren. "linkDisabled" : "false" // If watching, pay attention to key presses, looking for right sequence. "actions" : [ LITHIUM.Dialog.options['325902959'] = {"contentContext":" \n\n\t\n\t\t\n\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\t\t\n\t\t\t\t\t\tDu hast die maximal erlaubte Anzahl von Bewertungen für einen Beitrag erreicht.\n\t\t\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\n\n\t\t\t\n\t\t","dialogOptions":{"minHeight":174,"draggable":true,"maxHeight":600,"resizable":true,"autoOpen":false,"width":310,"minWidth":310,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modeless-simple","position":["center","center"],"modal":false,"maxWidth":310},"contentType":"html"}; ] "action" : "rerender" { LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_48","feedbackSelector":".InfoMessage"}); Juli 2020 bis zum 31. "actions" : [ } "selector" : "#kudosButtonV2_4", "}); "forceSearchRequestParameterForBlurbBuilder" : "false", "context" : "envParam:quiltName", "event" : "MessagesWidgetEditCommentForm", "kudosLinksDisabled" : "false", Warum muss ich mich für CallYa identifizieren? "initiatorDataMatcher" : "data-lia-message-uid" { "}); "componentId" : "kudos.widget.button", }, "context" : "", "event" : "MessagesWidgetEditAction", "event" : "MessagesWidgetEditAction", }); MwSt. LITHIUM.AjaxSupport.fromForm('#form_8', 'GiveRating', '#ajaxfeedback_8', 'LITHIUM:ajaxError', {"useLoader":true,"event":"submit","httpMethod":"POST"}, true); } ;(function($) { "event" : "removeThreadUserEmailSubscription", { }, "componentId" : "kudos.widget.button", }, $(document).ready(function() { "forceSearchRequestParameterForBlurbBuilder" : "false", "actions" : [ "event" : "RevokeSolutionAction", "useTruncatedSubject" : "true", } LITHIUM.StarRating('#any_6', false, 1, 'LITHIUM:starRating'); .attr('aria-selected','false'); "actions" : [ "initiatorDataMatcher" : "data-lia-message-uid" "action" : "rerender" { Diese senden wir nach Aufforderung unseren Kunden gern zu wenn Unstimmigkeiten vermutet werden. Telekom oder Vodafone - wer hat die besseren Prepaid Tarife? "event" : "MessagesWidgetCommentForm", ] "action" : "rerender" "event" : "kudoEntity", "context" : "", ] LITHIUM.AjaxSupport.ComponentEvents.set({ "selector" : "#kudosButtonV2_3", "event" : "ProductMessageEdit", }, if ( count == neededkeys.length ) { "event" : "kudoEntity", "eventActions" : [ { { "componentId" : "forums.widget.message-view", ;(function($) { }, LITHIUM.AjaxSupport.useTickets = false; } "actions" : [ Vodafone €15 Direct Top-up. LITHIUM.AjaxSupport.ComponentEvents.set({ ], LITHIUM.StarRating('#any_6', false, 1, 'LITHIUM:starRating'); "action" : "rerender" "quiltName" : "ForumMessage", { { $(".label-tag-accordion div.js-toggle-more").on('click',function(e){ { { "showCountOnly" : "false", Alle Preise inkl. "context" : "envParam:quiltName", { "context" : "", "action" : "rerender" }, ] "action" : "pulsate" { "action" : "rerender" } "context" : "", "actions" : [ "action" : "rerender" }, "triggerEvent" : "click", /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/
Joomla3 Appliance - Powered by TurnKey Linux